(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0169

BA000012.MLR0169     Location/Qualifiers
FT   CDS             118983..119393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0169"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47811"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47811"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF0"
FT                   /protein_id="BAB47811.1"
FT                   /translation="MTKDGNRSFSIEIADTDAEREAGLMFRQDMADDHGMLFVFEIQQQ
FT                   VSFWMQNTPMPLDLIFVGQDGKIRAVKHGEPQSQAIISPGVPVRFVLELKAGAAAKYGI
FT                   GYGDLLRHPAIGTVSGPGMPPPDNGDAPNGGG"
     MTKDGNRSFS IEIADTDAER EAGLMFRQDM ADDHGMLFVF EIQQQVSFWM QNTPMPLDLI        60
     FVGQDGKIRA VKHGEPQSQA IISPGVPVRF VLELKAGAAA KYGIGYGDLL RHPAIGTVSG       120
     PGMPPPDNGD APNGGG                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page