(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0179

BA000012.MLR0179     Location/Qualifiers
FT   CDS             124053..124418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0179"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47819"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47819"
FT                   /db_xref="GOA:Q98NE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE2"
FT                   /protein_id="BAB47819.1"
FT                   /translation="MRFHGKCKVKMAQMELFLFAFVVGLTVCGLTGSTMELVSGRKVAF
FT                   AEPYVSSAHVLRSLAATAGAGPFMLVNDALDARREKRISTMALLSCGCTAIAWSLALGI
FT                   VVLTIASWAIGLLGSGI"
     MRFHGKCKVK MAQMELFLFA FVVGLTVCGL TGSTMELVSG RKVAFAEPYV SSAHVLRSLA        60
     ATAGAGPFML VNDALDARRE KRISTMALLS CGCTAIAWSL ALGIVVLTIA SWAIGLLGSG       120
     I                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page