(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0180

BA000012.MLR0180     Location/Qualifiers
FT   CDS             124438..124965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0180"
FT                   /product="ferripyochelin binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47820"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47820"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE1"
FT                   /protein_id="BAB47820.1"
FT                   /translation="MPLYAIDGAEPSFADAGSNWIAPDATLIGDIRVGRNAGFWFGVVI
FT                   RGDNEPIIVGADTNVQEHTVMHTDPGFPLTIGEGCTIGHRAMLHGCTIGDNSLIGMGAI
FT                   VLNGARIGKNSLVGAGALVTEGKEFPDNSLIVGSPAKAIRVLDDAAVERLRGSAAHYVA
FT                   NGKRFKAGLKKV"
     MPLYAIDGAE PSFADAGSNW IAPDATLIGD IRVGRNAGFW FGVVIRGDNE PIIVGADTNV        60
     QEHTVMHTDP GFPLTIGEGC TIGHRAMLHG CTIGDNSLIG MGAIVLNGAR IGKNSLVGAG       120
     ALVTEGKEFP DNSLIVGSPA KAIRVLDDAA VERLRGSAAH YVANGKRFKA GLKKV            175
//

If you have problems or comments...

PBIL Back to PBIL home page