(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0190

BA000012.MLR0190     Location/Qualifiers
FT   CDS             130538..132037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0190"
FT                   /product="Glu-tRNA(Gln) amidotransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47828"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47828"
FT                   /db_xref="GOA:Q98ND3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98ND3"
FT                   /protein_id="BAB47828.1"
FT                   /translation="MTIIDTRTPDAKRLIPGATGDWEIIIGLEVHAQVISEAKLFSGAS
FT                   TAFGAAPNANVSLVDAAMPGMLPVINEECVKQAIRTGLGLKAQINHKSVFDRKNYFYPD
FT                   LPQGYQISQFKQPIVGEGTVIVSVGPDRQGEFEDIEVGIERLHLEQDAGKSMHDQHPTM
FT                   SYVDLNRSGVALMEIVSKPDLRSGDEAKAYVTKLRTIMRYLGTCDGNMDEGSLRADVNV
FT                   SVRRPGGEFGTRCEIKNMNSIRFIGQAIDYEARRQIAILEDGGKIDQETRLYDAVKGET
FT                   RSMRSKEEAHDYRYFPDPDLLPLEFDQAYVDALAKELPELPDDKKARLITSLGLSTYDA
FT                   SILVSEKSVADYFEKVAAGRDGKLAANWVINDLLGQLNKVGKDIENAPVSPDQLGAIID
FT                   LIKDGTISGKIAKDLFEIVWSEGGDPRALVESRGMKQVTDTGAIEKAVDEVIAANPDKV
FT                   EQARAKPTMAGWFVGQVMKATGGKANPQAVNDLVKAKLGIE"
     MTIIDTRTPD AKRLIPGATG DWEIIIGLEV HAQVISEAKL FSGASTAFGA APNANVSLVD        60
     AAMPGMLPVI NEECVKQAIR TGLGLKAQIN HKSVFDRKNY FYPDLPQGYQ ISQFKQPIVG       120
     EGTVIVSVGP DRQGEFEDIE VGIERLHLEQ DAGKSMHDQH PTMSYVDLNR SGVALMEIVS       180
     KPDLRSGDEA KAYVTKLRTI MRYLGTCDGN MDEGSLRADV NVSVRRPGGE FGTRCEIKNM       240
     NSIRFIGQAI DYEARRQIAI LEDGGKIDQE TRLYDAVKGE TRSMRSKEEA HDYRYFPDPD       300
     LLPLEFDQAY VDALAKELPE LPDDKKARLI TSLGLSTYDA SILVSEKSVA DYFEKVAAGR       360
     DGKLAANWVI NDLLGQLNKV GKDIENAPVS PDQLGAIIDL IKDGTISGKI AKDLFEIVWS       420
     EGGDPRALVE SRGMKQVTDT GAIEKAVDEV IAANPDKVEQ ARAKPTMAGW FVGQVMKATG       480
     GKANPQAVND LVKAKLGIE                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page