(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0199

BA000012.MLR0199     Location/Qualifiers
FT   CDS             135949..136545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0199"
FT                   /product="cellulase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47835"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47835"
FT                   /db_xref="InterPro:IPR019225"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NC6"
FT                   /protein_id="BAB47835.1"
FT                   /translation="MSFFNRISTGGLTLAAGLAVSTAAFAASPAPATPAAPAPAAPAGS
FT                   DRITNPVAEFAGIDKITGRIITFDVYIDETVQFGALQVTPRVCYSRPQNEEPKTDSFVE
FT                   VDEITLDRKIRRIFTGWMFAESPGLNAVEHAVYDVWLKECKQKSDVPAPDATKADAPKA
FT                   DASKPVATKPAAAKPAASPDAEQPDPTQPDTSDAN"
     MSFFNRISTG GLTLAAGLAV STAAFAASPA PATPAAPAPA APAGSDRITN PVAEFAGIDK        60
     ITGRIITFDV YIDETVQFGA LQVTPRVCYS RPQNEEPKTD SFVEVDEITL DRKIRRIFTG       120
     WMFAESPGLN AVEHAVYDVW LKECKQKSDV PAPDATKADA PKADASKPVA TKPAAAKPAA       180
     SPDAEQPDPT QPDTSDAN                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page