(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0200

BA000012.MLR0200     Location/Qualifiers
FT   CDS             136561..137007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0200"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47836"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47836"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NC5"
FT                   /protein_id="BAB47836.1"
FT                   /translation="MATMRWTTDDRASTRPEDISMSDTKRITASKKELLELEKGFWTGD
FT                   AAYYAANADTECLVAFPQMAKAMDNADLAKTATKPNRWRDLDIELKGIIEPGSDIIMLT
FT                   YEAHATRENGEPYAALVSTGYVHRVNGWKMMFHSQTPIEVAAAK"
     MATMRWTTDD RASTRPEDIS MSDTKRITAS KKELLELEKG FWTGDAAYYA ANADTECLVA        60
     FPQMAKAMDN ADLAKTATKP NRWRDLDIEL KGIIEPGSDI IMLTYEAHAT RENGEPYAAL       120
     VSTGYVHRVN GWKMMFHSQT PIEVAAAK                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page