(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0217

BA000012.MLR0217     Location/Qualifiers
FT   CDS             153709..154080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0217"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47849"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47849"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB2"
FT                   /protein_id="BAB47849.1"
FT                   /translation="MFAANSRSAIAVPSVGQLVLPLCAVIALLSAPAMAHDAKPTAAKP
FT                   QGWSYPFACCANYDCHEVSQTSISERPEGYVIKDTGEVLAYSDRRIKDSPDGEYHWCAH
FT                   EAGLDAGKTICLFVPPSSY"
     MFAANSRSAI AVPSVGQLVL PLCAVIALLS APAMAHDAKP TAAKPQGWSY PFACCANYDC        60
     HEVSQTSISE RPEGYVIKDT GEVLAYSDRR IKDSPDGEYH WCAHEAGLDA GKTICLFVPP       120
     SSY                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page