(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0219

BA000012.MLR0219     Location/Qualifiers
FT   CDS             154254..154556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0219"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47851"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47851"
FT                   /db_xref="GOA:Q98NB0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB0"
FT                   /protein_id="BAB47851.1"
FT                   /translation="MTQCTCSFCSKRGSLWAYYTPSQFKLITPLKNVSFYEWGSKTVKH
FT                   GFCANCGCGTFTETPDWSTGEPDFDNPKISVNSRLFDDFNLDKVEVVVIDGKNLW"
     MTQCTCSFCS KRGSLWAYYT PSQFKLITPL KNVSFYEWGS KTVKHGFCAN CGCGTFTETP        60
     DWSTGEPDFD NPKISVNSRL FDDFNLDKVE VVVIDGKNLW                             100
//

If you have problems or comments...

PBIL Back to PBIL home page