(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0223

BA000012.MLR0223     Location/Qualifiers
FT   CDS             155809..156189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0223"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47853"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47853"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA8"
FT                   /protein_id="BAB47853.1"
FT                   /translation="MDYPKGAMGVHFVNVPSVGQKLDPMKPNVLIYEPTKKGLKLVGVE
FT                   WLVPLTPNVKEVPTLFGQKFMGPMEGHYPLIPREFVHYDLHAWLFRDNPNGMFSPTNPN
FT                   VKCSKADFPMLEKPTKMMPGPM"
     MDYPKGAMGV HFVNVPSVGQ KLDPMKPNVL IYEPTKKGLK LVGVEWLVPL TPNVKEVPTL        60
     FGQKFMGPME GHYPLIPREF VHYDLHAWLF RDNPNGMFSP TNPNVKCSKA DFPMLEKPTK       120
     MMPGPM                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page