(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0227

BA000012.MLR0227     Location/Qualifiers
FT   CDS             159762..160796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0227"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47857"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47857"
FT                   /db_xref="GOA:Q98NA4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA4"
FT                   /protein_id="BAB47857.1"
FT                   /translation="MNWKLTAAAAGLSLLAATGVARADGELNIYNWGNYTSPDLIKKFE
FT                   DTYKVKVTVTDYDSNDTALAKVRQGASGYDIVVPSASVVPVWISEGLLLETDPNKMENF
FT                   KNVDPRWADVPFDPGRKYTVPWQWGTTGISVNKSVYSGDPNTSAIFLDPPPELVGKINV
FT                   VPEMGDIMFLAIAYEGGKYCTNDMQVLKKVHDKLVEAKAKWLSLDYAAVDGLGRGDIAA
FT                   GVNWNGISLRERLQNNKIVYGYPKEGFPIWMDNVAVLKDAKNVENAKLFQNFIMDPKNA
FT                   AMISAFARYANGIKGSEAFMPDDMKTAPEVDVPAEFAAKGQFMPACPSDVQALYTKIWT
FT                   DLQK"
     MNWKLTAAAA GLSLLAATGV ARADGELNIY NWGNYTSPDL IKKFEDTYKV KVTVTDYDSN        60
     DTALAKVRQG ASGYDIVVPS ASVVPVWISE GLLLETDPNK MENFKNVDPR WADVPFDPGR       120
     KYTVPWQWGT TGISVNKSVY SGDPNTSAIF LDPPPELVGK INVVPEMGDI MFLAIAYEGG       180
     KYCTNDMQVL KKVHDKLVEA KAKWLSLDYA AVDGLGRGDI AAGVNWNGIS LRERLQNNKI       240
     VYGYPKEGFP IWMDNVAVLK DAKNVENAKL FQNFIMDPKN AAMISAFARY ANGIKGSEAF       300
     MPDDMKTAPE VDVPAEFAAK GQFMPACPSD VQALYTKIWT DLQK                        344
//

If you have problems or comments...

PBIL Back to PBIL home page