(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0230

BA000012.MLR0230     Location/Qualifiers
FT   CDS             162343..163110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0230"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47859"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47859"
FT                   /db_xref="GOA:Q98NA2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA2"
FT                   /protein_id="BAB47859.1"
FT                   /translation="MAYVARQSVRRDMSAAGPKGLTNMAQRKTTAKPEKRKVVTKGAAN
FT                   DAAPPKDRRRERGEASVQRIIDATIELIAEEGLASLTMQRIAEHVGSSNALVVFHFRSK
FT                   ENLFRAVLQYLSDQYDALWITLVRAPGLSPVERLLGAVDCAQRFARQHPKWVSVFVVFS
FT                   SDRKSMQIYNEIGLPSDLAYTAEARELLIEISRSGGYAGVDINTLSESLNYLVHGAWYW
FT                   DHLNPSSRDTNVLRKTMLLLLHQAFPRHFELMP"
     MAYVARQSVR RDMSAAGPKG LTNMAQRKTT AKPEKRKVVT KGAANDAAPP KDRRRERGEA        60
     SVQRIIDATI ELIAEEGLAS LTMQRIAEHV GSSNALVVFH FRSKENLFRA VLQYLSDQYD       120
     ALWITLVRAP GLSPVERLLG AVDCAQRFAR QHPKWVSVFV VFSSDRKSMQ IYNEIGLPSD       180
     LAYTAEAREL LIEISRSGGY AGVDINTLSE SLNYLVHGAW YWDHLNPSSR DTNVLRKTML       240
     LLLHQAFPRH FELMP                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page