(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0239

BA000012.MLR0239     Location/Qualifiers
FT   CDS             169623..170501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0239"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47867"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47867"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N94"
FT                   /protein_id="BAB47867.1"
FT                   /translation="MAILVTGSTGTIGSQVLAHLQGHNVEVRALTRSPETAQFPAGVTA
FT                   VRGDLADPDSVRAALRGVSTLFLLAPNVADELTQAMLTLTVAREAGVKGIVYLSVFGGD
FT                   GYADVPHFAGKYTVERMIEALDLPATILRPAYFIQNDLRQKDGLLKTGVYGSPIGKKGV
FT                   SMVDIRDIGEAAAIELLRREQAATPLGRETYALVGPDSLTGEGIATIWREALGRAIRHG
FT                   GDDLVVMEQRTKTMLPAWHALDLRLMFSRYQTEGAVATADDIERLTKLLGHAPRSYTAF
FT                   ARDAAAQWTKG"
     MAILVTGSTG TIGSQVLAHL QGHNVEVRAL TRSPETAQFP AGVTAVRGDL ADPDSVRAAL        60
     RGVSTLFLLA PNVADELTQA MLTLTVAREA GVKGIVYLSV FGGDGYADVP HFAGKYTVER       120
     MIEALDLPAT ILRPAYFIQN DLRQKDGLLK TGVYGSPIGK KGVSMVDIRD IGEAAAIELL       180
     RREQAATPLG RETYALVGPD SLTGEGIATI WREALGRAIR HGGDDLVVME QRTKTMLPAW       240
     HALDLRLMFS RYQTEGAVAT ADDIERLTKL LGHAPRSYTA FARDAAAQWT KG               292
//

If you have problems or comments...

PBIL Back to PBIL home page