(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0270

BA000012.MLR0270     Location/Qualifiers
FT   CDS             190007..190534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0270"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47891"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47891"
FT                   /db_xref="GOA:Q98N71"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N71"
FT                   /protein_id="BAB47891.1"
FT                   /translation="MAARWYIVHAYSNFEKKVAEDIENKAKQKGLSADIEQIVVPTEKV
FT                   VEVRRGRKVDAERKFFPGYVLLKANLTDAVFSLVKNTPKVTGFLGDSKPVPITEAEAQR
FT                   ILNQVQEGVERPKPSVTFEIGEAIRVSDGPFASFNGFVQEVDEERARLKVEVSIFGRAV
FT                   PVDLEFGQVEKG"
     MAARWYIVHA YSNFEKKVAE DIENKAKQKG LSADIEQIVV PTEKVVEVRR GRKVDAERKF        60
     FPGYVLLKAN LTDAVFSLVK NTPKVTGFLG DSKPVPITEA EAQRILNQVQ EGVERPKPSV       120
     TFEIGEAIRV SDGPFASFNG FVQEVDEERA RLKVEVSIFG RAVPVDLEFG QVEKG            175
//

If you have problems or comments...

PBIL Back to PBIL home page