(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0273

BA000012.MLR0273     Location/Qualifiers
FT   CDS             191138..191836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0273"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47893"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47893"
FT                   /db_xref="GOA:Q98N69"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N69"
FT                   /protein_id="BAB47893.1"
FT                   /translation="MAKIAKRVSKTREGIDPNKAYALGEALKLLKDRSSVKFDETVEVA
FT                   MNLGVDPRHADQMVRGVVNLPNGTGRSVRVAVFARGDKAEEAKAAGADIVGAEDLVDIV
FT                   QKGTIDFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKVGTVTTDVAAAVKASKGGAVEF
FT                   RVEKAGIVHAGVGKVSFDVKALEENIRAFADAVTKAKPAGAKGNYVKKVSVTSTMGPGL
FT                   KLDVSTLAAS"
     MAKIAKRVSK TREGIDPNKA YALGEALKLL KDRSSVKFDE TVEVAMNLGV DPRHADQMVR        60
     GVVNLPNGTG RSVRVAVFAR GDKAEEAKAA GADIVGAEDL VDIVQKGTID FDRCIATPDM       120
     MPLVGRLGKV LGPRGMMPNP KVGTVTTDVA AAVKASKGGA VEFRVEKAGI VHAGVGKVSF       180
     DVKALEENIR AFADAVTKAK PAGAKGNYVK KVSVTSTMGP GLKLDVSTLA AS               232
//

If you have problems or comments...

PBIL Back to PBIL home page