(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0283

BA000012.MLR0283     Location/Qualifiers
FT   CDS             204878..205249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0283"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47901"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47901"
FT                   /db_xref="GOA:Q98N61"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N61"
FT                   /protein_id="BAB47901.1"
FT                   /translation="MPTVNQLIRKPRIAPVKRNKVPAMQQNPQKRGVCTRVYTTTPKKP
FT                   NSALRKVAKIRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDT
FT                   QGVKNRKQRRSKYGAKRPK"
     MPTVNQLIRK PRIAPVKRNK VPAMQQNPQK RGVCTRVYTT TPKKPNSALR KVAKIRLTNG        60
     FEVIGYIPGE GHNLQEHSVV MIRGGRVKDL PGVRYHIIRG VLDTQGVKNR KQRRSKYGAK       120
     RPK                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page