(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0284

BA000012.MLR0284     Location/Qualifiers
FT   CDS             205310..205780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0284"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47902"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47902"
FT                   /db_xref="GOA:Q98N60"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N60"
FT                   /protein_id="BAB47902.1"
FT                   /translation="MSRRHSAEKREINPDPKFGDLIVTKFMNAVMYDGKKSVAETIVYG
FT                   ALDQVQSKTKQEPVTVFHQALDNVAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWL
FT                   IAAARNRNETTMIDRLSGELMDAANNRGTAVKKREDTHKMAEANRAFAHYRW"
     MSRRHSAEKR EINPDPKFGD LIVTKFMNAV MYDGKKSVAE TIVYGALDQV QSKTKQEPVT        60
     VFHQALDNVA PHVEVRSRRV GGATYQVPVD VRPERRQALA IRWLIAAARN RNETTMIDRL       120
     SGELMDAANN RGTAVKKRED THKMAEANRA FAHYRW                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page