(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0286

BA000012.MLR0286     Location/Qualifiers
FT   CDS             205810..207900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0286"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47903"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47903"
FT                   /db_xref="GOA:Q98N59"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N59"
FT                   /protein_id="BAB47903.1"
FT                   /translation="MAREYKIEDYRNFGIMAHIDAGKTTTTERVLYYTGKSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWKGRDGKMRRFNIIDTPGHVDFTIEVERSLRVL
FT                   DGAIALLDANAGVEPQTETVWRQADKYRVPRMIFCNKMDKIGADFYRSVEMIGSRLGAQ
FT                   AVVMQLPIGAETEFKGVVDLVEMNALVWRDETLGAAWDVVEIPADLQARAQEYREKMIE
FT                   AAVEMDETALENYLEGKMPSNDEIRSLIRKGTIAVKFFPMFCGSAFKNKGVQPLLDAVV
FT                   EYLPSPADVPAIKGVDAKTDAEIERHAVDDEPLSMLAFKIMNDPFVGSLTFARIYSGKL
FT                   TKGISVDNTVKGKKERIGRMLQMHANSRADVEEAFAGDIVALAGLKDTTTGDTLCDPLH
FT                   PVILERMEFPDPVIQIAIEPKTKNDQEKMGLALHRLAAEDPSFRVKTDEESGQTIISGM
FT                   GELHLDIIVDRMRREFKVEANVGAPQVAYRETITRKHEQDYTHKKQTGGTGQFARVKVL
FT                   FEPNTESEEFVFESKIVGGAVPKEYIPGVEKGIQSVMGAGPFAGFPMIGVRATLIDGAY
FT                   HDVDSSVLAFEIASRACFREAAPKLGVQLLEPIMKVEVVTPEDYVGSVIGDLNGRRGQI
FT                   QGQEARGVAVVINAMVPLANMFKYVDNLRSMSQGRAAYTMQFDHYEPVPTAVAQEVQKK
FT                   YA"
     MAREYKIEDY RNFGIMAHID AGKTTTTERV LYYTGKSHKI GEVHDGAATM DWMEQEQERG        60
     ITITSAATTT FWKGRDGKMR RFNIIDTPGH VDFTIEVERS LRVLDGAIAL LDANAGVEPQ       120
     TETVWRQADK YRVPRMIFCN KMDKIGADFY RSVEMIGSRL GAQAVVMQLP IGAETEFKGV       180
     VDLVEMNALV WRDETLGAAW DVVEIPADLQ ARAQEYREKM IEAAVEMDET ALENYLEGKM       240
     PSNDEIRSLI RKGTIAVKFF PMFCGSAFKN KGVQPLLDAV VEYLPSPADV PAIKGVDAKT       300
     DAEIERHAVD DEPLSMLAFK IMNDPFVGSL TFARIYSGKL TKGISVDNTV KGKKERIGRM       360
     LQMHANSRAD VEEAFAGDIV ALAGLKDTTT GDTLCDPLHP VILERMEFPD PVIQIAIEPK       420
     TKNDQEKMGL ALHRLAAEDP SFRVKTDEES GQTIISGMGE LHLDIIVDRM RREFKVEANV       480
     GAPQVAYRET ITRKHEQDYT HKKQTGGTGQ FARVKVLFEP NTESEEFVFE SKIVGGAVPK       540
     EYIPGVEKGI QSVMGAGPFA GFPMIGVRAT LIDGAYHDVD SSVLAFEIAS RACFREAAPK       600
     LGVQLLEPIM KVEVVTPEDY VGSVIGDLNG RRGQIQGQEA RGVAVVINAM VPLANMFKYV       660
     DNLRSMSQGR AAYTMQFDHY EPVPTAVAQE VQKKYA                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page