(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0291

BA000012.MLR0291     Location/Qualifiers
FT   CDS             209583..210296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0291"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47906"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47906"
FT                   /db_xref="GOA:Q98N57"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N57"
FT                   /protein_id="BAB47906.1"
FT                   /translation="MRSGVIAKKVGMTRIYNDAGEHVPVTVLQMENCQVVAQRTQEKNG
FT                   YTAVQLGVGLAKVKNTSKAMRGHFATASVEPKAKVAEFRVSADNMIDVGAEITVEHFVA
FT                   GQKVDVTGTTIGKGFQGVIKRHHMGGGRATHGNSVSHRTHGSTGQRQDPGKVFKGKKMA
FT                   GHMGDTRVTTQNVEIVSTDADRGLILIRGAVPGSKGAWILVRDAAKVALPANAPKPAAI
FT                   RAAVKNEAPATEGAE"
     MRSGVIAKKV GMTRIYNDAG EHVPVTVLQM ENCQVVAQRT QEKNGYTAVQ LGVGLAKVKN        60
     TSKAMRGHFA TASVEPKAKV AEFRVSADNM IDVGAEITVE HFVAGQKVDV TGTTIGKGFQ       120
     GVIKRHHMGG GRATHGNSVS HRTHGSTGQR QDPGKVFKGK KMAGHMGDTR VTTQNVEIVS       180
     TDADRGLILI RGAVPGSKGA WILVRDAAKV ALPANAPKPA AIRAAVKNEA PATEGAE          237
//

If you have problems or comments...

PBIL Back to PBIL home page