(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0295

BA000012.MLR0295     Location/Qualifiers
FT   CDS             211229..212062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0295"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47909"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47909"
FT                   /db_xref="GOA:Q98N54"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N54"
FT                   /protein_id="BAB47909.1"
FT                   /translation="MALKKFNPVTPSTRQLVIVDRSGLYKGKPVKGLTEGLTKSGGRNN
FT                   YGRITARFIGGGHKRSYRIIDFKRRKFDVVGTVERIEYDPNRTAFIALIKYDDGELSYI
FT                   IAPQRLAAGDKIVAGEAVDVKPGNAMPLASMPVGTIVHNIELKPGKGGQVARSAGGYAQ
FT                   LVGRDQGMAILRLNSGEQRVVHGSCMATVGAVSNPDHGNINDGKAGRTVWRGKRPHNRG
FT                   VTMNPVDHPHGGGEGRTSGGRHPVSPWGKPTKGKKTRSNKATDKFILRSRHQRKS"
     MALKKFNPVT PSTRQLVIVD RSGLYKGKPV KGLTEGLTKS GGRNNYGRIT ARFIGGGHKR        60
     SYRIIDFKRR KFDVVGTVER IEYDPNRTAF IALIKYDDGE LSYIIAPQRL AAGDKIVAGE       120
     AVDVKPGNAM PLASMPVGTI VHNIELKPGK GGQVARSAGG YAQLVGRDQG MAILRLNSGE       180
     QRVVHGSCMA TVGAVSNPDH GNINDGKAGR TVWRGKRPHN RGVTMNPVDH PHGGGEGRTS       240
     GGRHPVSPWG KPTKGKKTRS NKATDKFILR SRHQRKS                                277
//

If you have problems or comments...

PBIL Back to PBIL home page