(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0301

BA000012.MLR0301     Location/Qualifiers
FT   CDS             213502..213915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0301"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47913"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47913"
FT                   /db_xref="GOA:Q98N50"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N50"
FT                   /protein_id="BAB47913.1"
FT                   /translation="MLQPKRTKFRKQFKGRIHGTAKGGTNLDFGGFGLKALEPNRVTAR
FT                   EIEAARRAITREMKRAGRVWIRIFPDLPVTSKPTEVRMGKGKGAVDYWAARVKPGRIMF
FT                   EIDGVSEETAREALRLGAAKLSVRTRFVQRIAE"
     MLQPKRTKFR KQFKGRIHGT AKGGTNLDFG GFGLKALEPN RVTAREIEAA RRAITREMKR        60
     AGRVWIRIFP DLPVTSKPTE VRMGKGKGAV DYWAARVKPG RIMFEIDGVS EETAREALRL       120
     GAAKLSVRTR FVQRIAE                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page