(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0310

BA000012.MLR0310     Location/Qualifiers
FT   CDS             216077..216475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0310"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47920"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47920"
FT                   /db_xref="GOA:Q98N43"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N43"
FT                   /protein_id="BAB47920.1"
FT                   /translation="MSLSDPLGDMLTRIRNAYGRKKSSVSTPASRLRTRVLDVLKAEGY
FT                   IRDYSQTDFDNGKSEIEIELKYFDGAPVVREIARVSKPGRRVYVSAKSIPHVANGLGIA
FT                   ILSTPKGVMADHEAREQNVGGEILCQIF"
     MSLSDPLGDM LTRIRNAYGR KKSSVSTPAS RLRTRVLDVL KAEGYIRDYS QTDFDNGKSE        60
     IEIELKYFDG APVVREIARV SKPGRRVYVS AKSIPHVANG LGIAILSTPK GVMADHEARE       120
     QNVGGEILCQ IF                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page