(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0312

BA000012.MLR0312     Location/Qualifiers
FT   CDS             216564..217097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0312"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47921"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47921"
FT                   /db_xref="GOA:Q98N42"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N42"
FT                   /protein_id="BAB47921.1"
FT                   /translation="MSRIGKKPVSLPQGVTATVNGQTVTAKGPKGELKFVVNDEVLVKM
FT                   EGSEIAVQPRDQTKTARSKWGMSRTQIVNILHGVKDGFEKKLEITGVGYRAAMQGKNLQ
FT                   LALGFSHDVVYETPAGVTIAVPKPTEITVTGIDKQQVGQVAAEIREYRGPEPYKGKGVR
FT                   YAGEKIVRKEGKKK"
     MSRIGKKPVS LPQGVTATVN GQTVTAKGPK GELKFVVNDE VLVKMEGSEI AVQPRDQTKT        60
     ARSKWGMSRT QIVNILHGVK DGFEKKLEIT GVGYRAAMQG KNLQLALGFS HDVVYETPAG       120
     VTIAVPKPTE ITVTGIDKQQ VGQVAAEIRE YRGPEPYKGK GVRYAGEKIV RKEGKKK          177
//

If you have problems or comments...

PBIL Back to PBIL home page