(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0318

BA000012.MLR0318     Location/Qualifiers
FT   CDS             218481..218954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0318"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47925"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47925"
FT                   /db_xref="GOA:Q98N38"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N38"
FT                   /protein_id="BAB47925.1"
FT                   /translation="MKLNDLRDKDGATHSKKRLGRGIGSGSGKTAGRGVKGQKARSGVA
FT                   INGFEGGQMPLYRRLPKRGFNNIFAKSFVVVSLARIQEAVDAKKLDAKATVTAEALVAA
FT                   GVIRRVKDGVRVLSDGELKAKLAFDVAGASKAAIEKIEKAGGSVKLPEKAAAE"
     MKLNDLRDKD GATHSKKRLG RGIGSGSGKT AGRGVKGQKA RSGVAINGFE GGQMPLYRRL        60
     PKRGFNNIFA KSFVVVSLAR IQEAVDAKKL DAKATVTAEA LVAAGVIRRV KDGVRVLSDG       120
     ELKAKLAFDV AGASKAAIEK IEKAGGSVKL PEKAAAE                                157
//

If you have problems or comments...

PBIL Back to PBIL home page