(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0326

BA000012.MLR0326     Location/Qualifiers
FT   CDS             223391..223822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0326"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47931"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47931"
FT                   /db_xref="GOA:Q98N32"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N32"
FT                   /protein_id="BAB47931.1"
FT                   /translation="MRHGFKGRRFARSISHRKSMFANLAVSLLEHEQIVTTLPKAKDLR
FT                   PIVEKLVTLGKRGDLHARRQVIAQIGNEGVVKRLFDTIAPRYANRNGGYLRIMKAGFRH
FT                   GDNAAMAVIEFVDRDTSAKGAGDRARLEAEGTDAEAAAA"
     MRHGFKGRRF ARSISHRKSM FANLAVSLLE HEQIVTTLPK AKDLRPIVEK LVTLGKRGDL        60
     HARRQVIAQI GNEGVVKRLF DTIAPRYANR NGGYLRIMKA GFRHGDNAAM AVIEFVDRDT       120
     SAKGAGDRAR LEAEGTDAEA AAA                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page