(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0330

BA000012.MLR0330     Location/Qualifiers
FT   CDS             226864..227526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0330"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47934"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47934"
FT                   /db_xref="GOA:Q98N29"
FT                   /db_xref="InterPro:IPR009273"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N29"
FT                   /protein_id="BAB47934.1"
FT                   /translation="MVVTLRSEASPWGISTSVALHALLAAMLALMPLPKRPKRLDEERV
FT                   SVDILTPQQFEASTRPPAPAPLPAPEAQASAPTPTPSAPRPTPPTAPTMIRPTEMLSAK
FT                   TLADPRSRQARADLATFASDERMVQLCNLEAMDQIRRWRADFRPERVVPYATAEEKVRG
FT                   TTIAADGAAFRSRKNWYSLKFKCRLARDGESVIGFEFLVGDPVARDKWDELGLPAVH"
     MVVTLRSEAS PWGISTSVAL HALLAAMLAL MPLPKRPKRL DEERVSVDIL TPQQFEASTR        60
     PPAPAPLPAP EAQASAPTPT PSAPRPTPPT APTMIRPTEM LSAKTLADPR SRQARADLAT       120
     FASDERMVQL CNLEAMDQIR RWRADFRPER VVPYATAEEK VRGTTIAADG AAFRSRKNWY       180
     SLKFKCRLAR DGESVIGFEF LVGDPVARDK WDELGLPAVH                             220
//

If you have problems or comments...

PBIL Back to PBIL home page