(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0331

BA000012.MLR0331     Location/Qualifiers
FT   CDS             227581..228516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0331"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47935"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47935"
FT                   /db_xref="GOA:Q98N28"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N28"
FT                   /protein_id="BAB47935.1"
FT                   /translation="MRRPKKPYQGARPGGGRCRDWAHSFATGSRSARGKMTKTLRKSLR
FT                   KFAIAIPLLALGFYFIPILTTIFIVCGLIDVLRNDRKDLALFSGYFLGNGLFTWLLSPF
FT                   NLLVDLLCYRNPGVWKLEQFPEDYQREVNEVLDIFRARKDEIIADIDANFGVGRRGMYV
FT                   YQWYGKHRIDNVAEFNKDFKYIKTIAVSVFSKRESTSWHFGPLRLSLRILYNLVPVKAE
FT                   IFVECGNVKNYWYDNPQFIFDDTLLHRSVNEYDGRRYCVFMDIIRPSPFPRLIAGMLAI
FT                   VSVSVERINSMFYKNWKMIGSTKPKKVETT"
     MRRPKKPYQG ARPGGGRCRD WAHSFATGSR SARGKMTKTL RKSLRKFAIA IPLLALGFYF        60
     IPILTTIFIV CGLIDVLRND RKDLALFSGY FLGNGLFTWL LSPFNLLVDL LCYRNPGVWK       120
     LEQFPEDYQR EVNEVLDIFR ARKDEIIADI DANFGVGRRG MYVYQWYGKH RIDNVAEFNK       180
     DFKYIKTIAV SVFSKRESTS WHFGPLRLSL RILYNLVPVK AEIFVECGNV KNYWYDNPQF       240
     IFDDTLLHRS VNEYDGRRYC VFMDIIRPSP FPRLIAGMLA IVSVSVERIN SMFYKNWKMI       300
     GSTKPKKVET T                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page