(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0333

BA000012.MLR0333     Location/Qualifiers
FT   CDS             230468..230842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0333"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47937"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47937"
FT                   /db_xref="GOA:Q98N26"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N26"
FT                   /protein_id="BAB47937.1"
FT                   /translation="MFNLLLVVVGGGIGAGIRHLTNMGALRLVGPNYPWGTMAINIVGS
FT                   FAMGLFIAILARRGGSNEVRLFVATGIFGGFTTFSAFSLDFATLWERGATLPAFGYALA
FT                   SVIGAIIALFLGLWLARSLP"
     MFNLLLVVVG GGIGAGIRHL TNMGALRLVG PNYPWGTMAI NIVGSFAMGL FIAILARRGG        60
     SNEVRLFVAT GIFGGFTTFS AFSLDFATLW ERGATLPAFG YALASVIGAI IALFLGLWLA       120
     RSLP                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page