(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0359

BA000012.MLR0359     Location/Qualifiers
FT   CDS             253684..254151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0359"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47957"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47957"
FT                   /db_xref="InterPro:IPR009593"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N06"
FT                   /protein_id="BAB47957.1"
FT                   /translation="MAIQFKALPTEHVRALQRGGPDAYSQTPERRISDGDGMPCRHCLK
FT                   NIAAGDAYLILAYRPFPELQPYAETGPIFLHAEECERAAETEALPEVLESPDYIVRGYG
FT                   RDDRIVYGSGGVIPTGAIAARAETLFERHDIAYVHVRSARNNCYQCRIERA"
     MAIQFKALPT EHVRALQRGG PDAYSQTPER RISDGDGMPC RHCLKNIAAG DAYLILAYRP        60
     FPELQPYAET GPIFLHAEEC ERAAETEALP EVLESPDYIV RGYGRDDRIV YGSGGVIPTG       120
     AIAARAETLF ERHDIAYVHV RSARNNCYQC RIERA                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page