(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0372

BA000012.MLR0372     Location/Qualifiers
FT   CDS             264605..265495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0372"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47966"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47966"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MZ7"
FT                   /protein_id="BAB47966.1"
FT                   /translation="MTDRPTTGTHPLDHLVLPTGSLEVARARLTSLGFVVAPTGIHPFG
FT                   TENCCVFLADGTYLEPLAIGNEQAAIDATADGNVFVARDRLHRDSRGDEGFSAVALGTD
FT                   NADADHARFVDAGLSAGDTLSFSRAFTDTSGKSDTASFRLAFAATRGAPDAFLFACQRI
FT                   NAPMVDRTALQAHANGATGILEVVAISDQPAEQYRMISVAANDPAANGEGRTFLLPNAT
FT                   LSVLDAKSFTARFGIPAGSSTKLRFAAIVFAVRSIDVASSLLAANAIQHDIAGTDIVVR
FT                   PASGQGAAFIFREIP"
     MTDRPTTGTH PLDHLVLPTG SLEVARARLT SLGFVVAPTG IHPFGTENCC VFLADGTYLE        60
     PLAIGNEQAA IDATADGNVF VARDRLHRDS RGDEGFSAVA LGTDNADADH ARFVDAGLSA       120
     GDTLSFSRAF TDTSGKSDTA SFRLAFAATR GAPDAFLFAC QRINAPMVDR TALQAHANGA       180
     TGILEVVAIS DQPAEQYRMI SVAANDPAAN GEGRTFLLPN ATLSVLDAKS FTARFGIPAG       240
     SSTKLRFAAI VFAVRSIDVA SSLLAANAIQ HDIAGTDIVV RPASGQGAAF IFREIP           296
//

If you have problems or comments...

PBIL Back to PBIL home page