(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0396

BA000012.MLR0396     Location/Qualifiers
FT   CDS             280968..282041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0396"
FT                   /product="nitrogen reguration protein; NifR3"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47985"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47985"
FT                   /db_xref="GOA:Q98MX8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX8"
FT                   /protein_id="BAB47985.1"
FT                   /translation="MARECATNGHAWFLCMVNSARLAAPLNVGGVEIRNRVFLAPMSGI
FT                   TDEPFRRRAHAHGAGLVVSEMVASGELAKGRAGFDLRIRHSGLPVHMVQLAGREAIHMA
FT                   EGARIAAGEGADIIDINMGCPAKKVTGGYAGSALMLDLDHALSLIEAVVGAVKVPVTVK
FT                   MRLGWDEGALNAPILARRAEQAGVKMVTVHGRTRCQFYQGKADWRAIARVKEAVSIPVV
FT                   ANGDVCSPAEAAAILDQSGADAVMVGRAHYGAPWIAGGIAAAAAGEVAANVPENRAALA
FT                   DYIVGHYEDMLALYGVESGLRQARKHLGWYLDRHAVGVADDDRKAILTAFDPARVIALL
FT                   RNVFSRDPQPLSLRSAA"
     MARECATNGH AWFLCMVNSA RLAAPLNVGG VEIRNRVFLA PMSGITDEPF RRRAHAHGAG        60
     LVVSEMVASG ELAKGRAGFD LRIRHSGLPV HMVQLAGREA IHMAEGARIA AGEGADIIDI       120
     NMGCPAKKVT GGYAGSALML DLDHALSLIE AVVGAVKVPV TVKMRLGWDE GALNAPILAR       180
     RAEQAGVKMV TVHGRTRCQF YQGKADWRAI ARVKEAVSIP VVANGDVCSP AEAAAILDQS       240
     GADAVMVGRA HYGAPWIAGG IAAAAAGEVA ANVPENRAAL ADYIVGHYED MLALYGVESG       300
     LRQARKHLGW YLDRHAVGVA DDDRKAILTA FDPARVIALL RNVFSRDPQP LSLRSAA          357
//

If you have problems or comments...

PBIL Back to PBIL home page