(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0398

BA000012.MLR0398     Location/Qualifiers
FT   CDS             283177..284637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0398"
FT                   /product="nitrogen assimilation regulatory protein; NtrC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47987"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47987"
FT                   /db_xref="GOA:Q98MX6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX6"
FT                   /protein_id="BAB47987.1"
FT                   /translation="MTARGNILVADDDAAIRTVLNQALSRVGHEVRVTSNASTLWRWVA
FT                   AGEGDLVITDVVMPDENAFDMLPRIKKARPELPVIVMSAQNTFMTAIRASETGAYEYLP
FT                   KPFDLTELLNIVNRALSEPRRPKIDARPDEQPETMPLVGRSAAMQDIYRMLARMMQTDL
FT                   TVMISGESGTGKELVARALHEYGRRRGGPFVAINMAAIPRDLIESELFGHEKGAFTGAQ
FT                   NRSTGRFEQAEGGTLFLDEIGDMPMEAQTRLLRVLQQGEYTTVGGRTPIKTDVRIVAAT
FT                   NKDLRTLINQGLFREDLFYRLNVVPLRLPALRERSEDVPDLVRHFFKLGEMEGLQTKRI
FT                   SSGGIELMKRYPWPGNVRELENLVRRLAALYSQDEISAEIIEAELKTGERPVVPGGGNL
FT                   IPDDLSIGQAVEHFLQRYFASFAGELPPAGLYQRILSEVEYPLVLASMTATRGNQIKAA
FT                   ELLGLNRNTLRKKIRELGVNVYKSSRPG"
     MTARGNILVA DDDAAIRTVL NQALSRVGHE VRVTSNASTL WRWVAAGEGD LVITDVVMPD        60
     ENAFDMLPRI KKARPELPVI VMSAQNTFMT AIRASETGAY EYLPKPFDLT ELLNIVNRAL       120
     SEPRRPKIDA RPDEQPETMP LVGRSAAMQD IYRMLARMMQ TDLTVMISGE SGTGKELVAR       180
     ALHEYGRRRG GPFVAINMAA IPRDLIESEL FGHEKGAFTG AQNRSTGRFE QAEGGTLFLD       240
     EIGDMPMEAQ TRLLRVLQQG EYTTVGGRTP IKTDVRIVAA TNKDLRTLIN QGLFREDLFY       300
     RLNVVPLRLP ALRERSEDVP DLVRHFFKLG EMEGLQTKRI SSGGIELMKR YPWPGNVREL       360
     ENLVRRLAAL YSQDEISAEI IEAELKTGER PVVPGGGNLI PDDLSIGQAV EHFLQRYFAS       420
     FAGELPPAGL YQRILSEVEY PLVLASMTAT RGNQIKAAEL LGLNRNTLRK KIRELGVNVY       480
     KSSRPG                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page