(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0399

BA000012.MLR0399     Location/Qualifiers
FT   CDS             284838..287054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0399"
FT                   /product="nitrogen regulation protein; NtrY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47988"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47988"
FT                   /db_xref="GOA:Q98MX5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX5"
FT                   /protein_id="BAB47988.1"
FT                   /translation="MLALPGVVAVVGALVMAAISFTILVGATPIAPDARTTWALIALNA
FT                   AFVLFLMALVGREVHRIVMARRHGKAASRLHVRIVAMFALVAAIPAIMVAIIASITLDI
FT                   GLDRWFEIRTKTIVNSSLSIADAYVQENARNLQGTTLSMAYDLDASRSLYGLDRTGFLD
FT                   LLNKEAVGRSLAHAALIKPDGSFVMSAQTDADFAMPEPPEGSVSSATDGKPVLIEPRTR
FT                   NIMGAIVKLREIEGLYLYTIRLVDPEVIKARQIVRSNTDEYRNLEDNRRTSQVAFALPY
FT                   LSLTLIIILSAIWTGIAVADRLVRPIRQLIGAADEVATGNLDVAVPVRSSDGDVASLGD
FT                   TFNKMLLELKSQRNEILSAKDLIDERRRFSEAVLAGVTAGVIGVDPYGIVTIVNRSAES
FT                   MLAISASAALGQNLSAILPHVGRVFEIGRQSGKPVYREQVTFFRAGTERTFNVQITIEA
FT                   GDDGSEEKSYVVTVDDITDLVQAQRSSAWADVARRIAHEIKNPLTPIQLSAERIKRRYG
FT                   KVITEDREVFDQCTDTIIRQVEDIGRMVDEFSAFARMPKPEMKAIDLRESLREASFLVE
FT                   VSRADITFERIFGNEPLKGTFDSRLLAQAFGNVIKNAAEAIDGLEQKDGSHGIIRIQAG
FT                   RQNGAIRIDVIDNGKGLPRENRQRLLEPYMTTREKGTGLGLAIVKKIVEDHGGRLELHD
FT                   APADFHGGRGAMISIILPLAAVTPLRGEGKTEHERETEKVGNGV"
     MLALPGVVAV VGALVMAAIS FTILVGATPI APDARTTWAL IALNAAFVLF LMALVGREVH        60
     RIVMARRHGK AASRLHVRIV AMFALVAAIP AIMVAIIASI TLDIGLDRWF EIRTKTIVNS       120
     SLSIADAYVQ ENARNLQGTT LSMAYDLDAS RSLYGLDRTG FLDLLNKEAV GRSLAHAALI       180
     KPDGSFVMSA QTDADFAMPE PPEGSVSSAT DGKPVLIEPR TRNIMGAIVK LREIEGLYLY       240
     TIRLVDPEVI KARQIVRSNT DEYRNLEDNR RTSQVAFALP YLSLTLIIIL SAIWTGIAVA       300
     DRLVRPIRQL IGAADEVATG NLDVAVPVRS SDGDVASLGD TFNKMLLELK SQRNEILSAK       360
     DLIDERRRFS EAVLAGVTAG VIGVDPYGIV TIVNRSAESM LAISASAALG QNLSAILPHV       420
     GRVFEIGRQS GKPVYREQVT FFRAGTERTF NVQITIEAGD DGSEEKSYVV TVDDITDLVQ       480
     AQRSSAWADV ARRIAHEIKN PLTPIQLSAE RIKRRYGKVI TEDREVFDQC TDTIIRQVED       540
     IGRMVDEFSA FARMPKPEMK AIDLRESLRE ASFLVEVSRA DITFERIFGN EPLKGTFDSR       600
     LLAQAFGNVI KNAAEAIDGL EQKDGSHGII RIQAGRQNGA IRIDVIDNGK GLPRENRQRL       660
     LEPYMTTREK GTGLGLAIVK KIVEDHGGRL ELHDAPADFH GGRGAMISII LPLAAVTPLR       720
     GEGKTEHERE TEKVGNGV                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page