(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0400

BA000012.MLR0400     Location/Qualifiers
FT   CDS             287044..288405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0400"
FT                   /product="nitrogen assimilation regulatory protein; NtrX"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47989"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47989"
FT                   /db_xref="GOA:Q98MX4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX4"
FT                   /protein_id="BAB47989.1"
FT                   /translation="MASDILIVDDEEDIRELVAGILSDEGHETRTAFDADSALAAIADR
FT                   APRLIFLDIWLQGSRLDGLALLDEIKTMHPTLPVVMISGHGNIETAVSAIRRGAYDFIE
FT                   KPFKADRLILIAERALETSKLRREVSDLKQRSGETFDLIGMSSAMSQLRQTIERVAPTN
FT                   SRVMIIGPSGSGKELAARAIHTLSARKGAPFVTLSAANITPERMEIELFGTESNGVERK
FT                   VGALEEAHRGILYIDEVADMPRETQNKILRVLVEQQFERVGGTKRVKVDVRIISSTSQN
FT                   LEAMIADGRFREDLYHRLAVVPVMVPGLAERREDIPYLVDNFMKQIARQAGIKPRRIGD
FT                   DALAVLQAHNWPGNVRQLRNNVERLMILARGDDVDAPITADLLPSEIGDVMPRTPNQSD
FT                   QHIMALPLREAREQFEKDYLIAQINRFGGNISKTAEFIGMERSALHRKLKSLGV"
     MASDILIVDD EEDIRELVAG ILSDEGHETR TAFDADSALA AIADRAPRLI FLDIWLQGSR        60
     LDGLALLDEI KTMHPTLPVV MISGHGNIET AVSAIRRGAY DFIEKPFKAD RLILIAERAL       120
     ETSKLRREVS DLKQRSGETF DLIGMSSAMS QLRQTIERVA PTNSRVMIIG PSGSGKELAA       180
     RAIHTLSARK GAPFVTLSAA NITPERMEIE LFGTESNGVE RKVGALEEAH RGILYIDEVA       240
     DMPRETQNKI LRVLVEQQFE RVGGTKRVKV DVRIISSTSQ NLEAMIADGR FREDLYHRLA       300
     VVPVMVPGLA ERREDIPYLV DNFMKQIARQ AGIKPRRIGD DALAVLQAHN WPGNVRQLRN       360
     NVERLMILAR GDDVDAPITA DLLPSEIGDV MPRTPNQSDQ HIMALPLREA REQFEKDYLI       420
     AQINRFGGNI SKTAEFIGME RSALHRKLKS LGV                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page