(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0408

BA000012.MLR0408     Location/Qualifiers
FT   CDS             294697..295470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0408"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47997"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47997"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW6"
FT                   /protein_id="BAB47997.1"
FT                   /translation="MSALVDPVTDTDLDAYVDDQLDVTRRIEVEAFLSTRPEAAARVMS
FT                   DLRTRDELRVALAGSKGMARPATADAARRLERGLARGRIFGVLQRSAAVAAFVAAGWLA
FT                   NGIIGPMSVTKVVASPQPPAYVDEAVRAHRTTLVRETMPSQPEAPNYSAGEIRAATAIV
FT                   MPSLPKDWKVRDVQIYPSRFGPSVEMAVDTKDMGLVSLFAIRPGTFDVVKPTVAPSGDI
FT                   SSAYFQIGEVAYAVVAKSGVRDLDRAAETLARTLY"
     MSALVDPVTD TDLDAYVDDQ LDVTRRIEVE AFLSTRPEAA ARVMSDLRTR DELRVALAGS        60
     KGMARPATAD AARRLERGLA RGRIFGVLQR SAAVAAFVAA GWLANGIIGP MSVTKVVASP       120
     QPPAYVDEAV RAHRTTLVRE TMPSQPEAPN YSAGEIRAAT AIVMPSLPKD WKVRDVQIYP       180
     SRFGPSVEMA VDTKDMGLVS LFAIRPGTFD VVKPTVAPSG DISSAYFQIG EVAYAVVAKS       240
     GVRDLDRAAE TLARTLY                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page