(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0421

BA000012.MLR0421     Location/Qualifiers
FT   CDS             303476..304639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0421"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48006"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48006"
FT                   /db_xref="GOA:Q98MV7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV7"
FT                   /protein_id="BAB48006.1"
FT                   /translation="MGRCKGRSRSVVSRRCKRQTGMATTTQYDPRQSLDARLRQAGASK
FT                   TVYALVTPEIETVKAELLGNSGGNGPDPIRVAYLDQFRHAWTGKQNALHRRFFDTWLGW
FT                   AKPMAPLDAADYPFSYPTSGASEPLFHLIADYGNRARLERFPPRLVIFRGEYEGYKAYA
FT                   EACGIAVAEYERHAWRDVADTVDPKDLLCLSQPSAIDGMVWPQANAFLRRLSLRANPAQ
FT                   LVLDLTYVGATAEPPAETILAGAPCVSAVVISLSKPFGAYYDRIGGVFCRSENLGLFGN
FT                   QWFKNLTSLQLGIRLMERFDVFAMARRYTGIQGSVAEHAGRALGLALTPADVFILAQAT
FT                   ASAENDPDLAAYLTRAPGAADSRPRLCLTPGMAERIGMAGANSGTLS"
     MGRCKGRSRS VVSRRCKRQT GMATTTQYDP RQSLDARLRQ AGASKTVYAL VTPEIETVKA        60
     ELLGNSGGNG PDPIRVAYLD QFRHAWTGKQ NALHRRFFDT WLGWAKPMAP LDAADYPFSY       120
     PTSGASEPLF HLIADYGNRA RLERFPPRLV IFRGEYEGYK AYAEACGIAV AEYERHAWRD       180
     VADTVDPKDL LCLSQPSAID GMVWPQANAF LRRLSLRANP AQLVLDLTYV GATAEPPAET       240
     ILAGAPCVSA VVISLSKPFG AYYDRIGGVF CRSENLGLFG NQWFKNLTSL QLGIRLMERF       300
     DVFAMARRYT GIQGSVAEHA GRALGLALTP ADVFILAQAT ASAENDPDLA AYLTRAPGAA       360
     DSRPRLCLTP GMAERIGMAG ANSGTLS                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page