(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0480

BA000012.MLR0480     Location/Qualifiers
FT   CDS             351083..351436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0480"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48059"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48059"
FT                   /db_xref="InterPro:IPR022444"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ4"
FT                   /protein_id="BAB48059.1"
FT                   /translation="MKPHVRAAVAAIALSHSSGRNVSSVYSYSELKYVNIDASVQGNVV
FT                   DAYDYNNSCHIDGTLPSLYHYGQNSHIDLQPQSGGQYDGYDYGSNSHFELTVSGNSAEL
FT                   YDYGEGGFFSFST"
     MKPHVRAAVA AIALSHSSGR NVSSVYSYSE LKYVNIDASV QGNVVDAYDY NNSCHIDGTL        60
     PSLYHYGQNS HIDLQPQSGG QYDGYDYGSN SHFELTVSGN SAELYDYGEG GFFSFST          117
//

If you have problems or comments...

PBIL Back to PBIL home page