(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0488

BA000012.MLR0488     Location/Qualifiers
FT   CDS             360340..360933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0488"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48066"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP7"
FT                   /protein_id="BAB48066.1"
FT                   /translation="MSNAATLQNEGGIVMLINRRRVLEVAAALPIISVASSITTSAASA
FT                   AAFDFSSIKTVKQFGAEVIGRADLSRAACEVALKKATRADAKEFAGFELKEAETVIAVL
FT                   KELGTPLPPMGDAAKSALEHIAGSAAGTAFDTAYIGAEYENHAFLRDLAEAYLKNSDPS
FT                   DPSEQHGRQLATVAHWAFWEHTALTQRIARELAA"
     MSNAATLQNE GGIVMLINRR RVLEVAAALP IISVASSITT SAASAAAFDF SSIKTVKQFG        60
     AEVIGRADLS RAACEVALKK ATRADAKEFA GFELKEAETV IAVLKELGTP LPPMGDAAKS       120
     ALEHIAGSAA GTAFDTAYIG AEYENHAFLR DLAEAYLKNS DPSDPSEQHG RQLATVAHWA       180
     FWEHTALTQR IARELAA                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page