(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0519

BA000012.MLR0519     Location/Qualifiers
FT   CDS             383247..385232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0519"
FT                   /product="ATP-binding protein of ABC-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48090"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48090"
FT                   /db_xref="GOA:Q98MM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM3"
FT                   /protein_id="BAB48090.1"
FT                   /translation="MIRIGRRSQESVPDRLHRGPAGRSHLTPVSSMRSFWGLMKAYWFS
FT                   ERWKEAWTLTVVIALLTALSSKAGVWFALALGELGNSIAFFHDAANTSPLQAILTNAGI
FT                   LVLLVVLKDAGFTGVRGLVSATLHRKWRGWLNSQFNKALLDGNHTHFHAQHGSAAGGIV
FT                   APDNIDQRIQESIKDMTGGAIGLAMGVLGVATSLYFIGENLIGSSVEVKGLEFLGGYGS
FT                   AVLAFLAVAIYVPLNTWIAVKLGRLLERLNIRMQQAEGSYRSELTTFLRRSFHVAASHG
FT                   EDVQKSMHDKLYVDIDKTWGKLNVVNNGYTSFELIYNFLGARIVAYGPGLVSFIHNRLD
FT                   YKGYITGSEMVAQLISQCSWFIHVMPAIATLRANSQRVTELANAIENVQHPQAFYSQTG
FT                   QSDFHYASQNPVFGLTIQKLELAHQGEDATPFLSAANLRFRRGEWTFLKGESGCGKTSL
FT                   IKAINGLWPYGRGTIVFPDGVKSFYAAQEVKLQQVSLKQLVCLPGSEHDHGDAQVASAL
FT                   HKAGLGDFIEHMANESREGKSWDQVLSGGQKQKLVVARIILQQPGLLFLDEATGALDPE
FT                   GKIAFHQAIKDNCPDVTVISVMHEAVAPRSAAGTEFYHSIVLIADGVATKKPLTPTLPV
FT                   ELTTILTQPRPVEDKWLRFSRRLKQK"
     MIRIGRRSQE SVPDRLHRGP AGRSHLTPVS SMRSFWGLMK AYWFSERWKE AWTLTVVIAL        60
     LTALSSKAGV WFALALGELG NSIAFFHDAA NTSPLQAILT NAGILVLLVV LKDAGFTGVR       120
     GLVSATLHRK WRGWLNSQFN KALLDGNHTH FHAQHGSAAG GIVAPDNIDQ RIQESIKDMT       180
     GGAIGLAMGV LGVATSLYFI GENLIGSSVE VKGLEFLGGY GSAVLAFLAV AIYVPLNTWI       240
     AVKLGRLLER LNIRMQQAEG SYRSELTTFL RRSFHVAASH GEDVQKSMHD KLYVDIDKTW       300
     GKLNVVNNGY TSFELIYNFL GARIVAYGPG LVSFIHNRLD YKGYITGSEM VAQLISQCSW       360
     FIHVMPAIAT LRANSQRVTE LANAIENVQH PQAFYSQTGQ SDFHYASQNP VFGLTIQKLE       420
     LAHQGEDATP FLSAANLRFR RGEWTFLKGE SGCGKTSLIK AINGLWPYGR GTIVFPDGVK       480
     SFYAAQEVKL QQVSLKQLVC LPGSEHDHGD AQVASALHKA GLGDFIEHMA NESREGKSWD       540
     QVLSGGQKQK LVVARIILQQ PGLLFLDEAT GALDPEGKIA FHQAIKDNCP DVTVISVMHE       600
     AVAPRSAAGT EFYHSIVLIA DGVATKKPLT PTLPVELTTI LTQPRPVEDK WLRFSRRLKQ       660
     K                                                                       661
//

If you have problems or comments...

PBIL Back to PBIL home page