(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0521

BA000012.MLR0521     Location/Qualifiers
FT   CDS             385505..386869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0521"
FT                   /product="Mg2+ transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48091"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48091"
FT                   /db_xref="GOA:Q98MM2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM2"
FT                   /protein_id="BAB48091.1"
FT                   /translation="MNDFSPVADDEAVAIARILANDHVADVVEALNHESRETATDLLCA
FT                   VPFERLVEIFDQPELDGAPELADALPRAKASKLLTAMSVDRAADILRELDEPARSELLG
FT                   ALAPPLRATLLSILGYPEGSAASIMTTEFVSVPSDWTVGRTLDYIRKVERTRETVYAIY
FT                   IVDPQTHLLVRSTGLRRLITGEPDDPVLSVAPDRVPVTVTPLTDRETLAQTISKYDLLA
FT                   VPVVDHGKILGIVTIDDIIDTMIEETTEDVHRFGGMEALDEPYMKMSFLAMIQKRAGWL
FT                   CALFLSEMLTANAMQSYESELERAIVLTLFIPLIMSSGGNSGSQATSLVIRAMALREIG
FT                   LGDWWRVALRELPTGLVLGSILGVVGVCRITLWQYFGFYDYGPHWPLIAATVGAALVGI
FT                   VTFGSLSGSMLPFALKRVGFDPASASAPFVATLVDVTGLVIYFSVAQVILRGTLL"
     MNDFSPVADD EAVAIARILA NDHVADVVEA LNHESRETAT DLLCAVPFER LVEIFDQPEL        60
     DGAPELADAL PRAKASKLLT AMSVDRAADI LRELDEPARS ELLGALAPPL RATLLSILGY       120
     PEGSAASIMT TEFVSVPSDW TVGRTLDYIR KVERTRETVY AIYIVDPQTH LLVRSTGLRR       180
     LITGEPDDPV LSVAPDRVPV TVTPLTDRET LAQTISKYDL LAVPVVDHGK ILGIVTIDDI       240
     IDTMIEETTE DVHRFGGMEA LDEPYMKMSF LAMIQKRAGW LCALFLSEML TANAMQSYES       300
     ELERAIVLTL FIPLIMSSGG NSGSQATSLV IRAMALREIG LGDWWRVALR ELPTGLVLGS       360
     ILGVVGVCRI TLWQYFGFYD YGPHWPLIAA TVGAALVGIV TFGSLSGSML PFALKRVGFD       420
     PASASAPFVA TLVDVTGLVI YFSVAQVILR GTLL                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page