(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0530

BA000012.MLR0530     Location/Qualifiers
FT   CDS             391439..392227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0530"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48097"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48097"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML6"
FT                   /protein_id="BAB48097.1"
FT                   /translation="MICTPGVGSAVGLGAVMRFSVRTDVILVLAVILAGGMLATPSARA
FT                   DGPSFDCAKASLPAEKAICADPQLSAIDLLVAKAYKGFEPAFGGDKRKIARGLIADRNA
FT                   CKSDTACIVSALNNALQTYGNAPSWVQDYNIALIGKKALDTAARNPGNNDQPLPSAVGQ
FT                   CASTHIKTLTARLGDAPLETASPDAGSAATFTNGGGAVSYDREPGLAASKVGEPVVMCL
FT                   IAVPRDCPKGDDRGRVYYSIDLVAKGSWALPDSEHLCGGA"
     MICTPGVGSA VGLGAVMRFS VRTDVILVLA VILAGGMLAT PSARADGPSF DCAKASLPAE        60
     KAICADPQLS AIDLLVAKAY KGFEPAFGGD KRKIARGLIA DRNACKSDTA CIVSALNNAL       120
     QTYGNAPSWV QDYNIALIGK KALDTAARNP GNNDQPLPSA VGQCASTHIK TLTARLGDAP       180
     LETASPDAGS AATFTNGGGA VSYDREPGLA ASKVGEPVVM CLIAVPRDCP KGDDRGRVYY       240
     SIDLVAKGSW ALPDSEHLCG GA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page