(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0532

BA000012.MLR0532     Location/Qualifiers
FT   CDS             392340..392822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0532"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48098"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48098"
FT                   /db_xref="GOA:Q98ML5"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML5"
FT                   /protein_id="BAB48098.1"
FT                   /translation="MGMATAKYVMKRILMMLAGYLVAVLVGLVAVAAIYAALSSLPNAP
FT                   AYFDVMGVSPIAVLVVPPLGMFVYFLTIVVTGLQTLIFALIAEFFSLRNALMHMVFGAA
FT                   AAAGGFFLIWPVPAEDMDPERWADIGIIAAAGLVAGLIYWLIAGREAGFRRPLSQI"
     MGMATAKYVM KRILMMLAGY LVAVLVGLVA VAAIYAALSS LPNAPAYFDV MGVSPIAVLV        60
     VPPLGMFVYF LTIVVTGLQT LIFALIAEFF SLRNALMHMV FGAAAAAGGF FLIWPVPAED       120
     MDPERWADIG IIAAAGLVAG LIYWLIAGRE AGFRRPLSQI                             160
//

If you have problems or comments...

PBIL Back to PBIL home page