(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0536

BA000012.MLR0536     Location/Qualifiers
FT   CDS             396438..396833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0536"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48102"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48102"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML1"
FT                   /protein_id="BAB48102.1"
FT                   /translation="MKKGYRELLDEANAEIEVVSPEEAAGLLEDEGTIFVDLRDPREVE
FT                   RDGGIPGAKHVTRGMLEFWIDPESPYHKPFFASGKSFVFFCAGGWRSALATKTAQDMGL
FT                   VPVKHILGGYTAWKAAGLPVEPGEKKK"
     MKKGYRELLD EANAEIEVVS PEEAAGLLED EGTIFVDLRD PREVERDGGI PGAKHVTRGM        60
     LEFWIDPESP YHKPFFASGK SFVFFCAGGW RSALATKTAQ DMGLVPVKHI LGGYTAWKAA       120
     GLPVEPGEKK K                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page