(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0556

BA000012.MLR0556     Location/Qualifiers
FT   CDS             408685..409152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0556"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48119"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48119"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ4"
FT                   /protein_id="BAB48119.1"
FT                   /translation="MNHFTSITGLAAALSLCAAGASAETMHIFWKDLRPATQLAGYALP
FT                   VDRDGDLVYQFLLVPWTGACSHMPTPPPNQIVLVTPAHPYKMSQAYQSVAVTGALKPDI
FT                   EKSQLFILDGVSVIQSGYSVRKADVIGVDTVPDTVTLPVNSPWSFLNKKKN"
     MNHFTSITGL AAALSLCAAG ASAETMHIFW KDLRPATQLA GYALPVDRDG DLVYQFLLVP        60
     WTGACSHMPT PPPNQIVLVT PAHPYKMSQA YQSVAVTGAL KPDIEKSQLF ILDGVSVIQS       120
     GYSVRKADVI GVDTVPDTVT LPVNSPWSFL NKKKN                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page