(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0568

BA000012.MLR0568     Location/Qualifiers
FT   CDS             417086..417424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0568"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48130"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48130"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI3"
FT                   /protein_id="BAB48130.1"
FT                   /translation="MATLHYASGGSATDVATTGFNLVDVSSVDELNALPAGTKGLVWLD
FT                   EANGATSSFIQKVTPFIGNPNVFGFFLVDEPDPTGKWGTYATADNLKADQPARRQDLHH
FT                   HDEHGVFG"
     MATLHYASGG SATDVATTGF NLVDVSSVDE LNALPAGTKG LVWLDEANGA TSSFIQKVTP        60
     FIGNPNVFGF FLVDEPDPTG KWGTYATADN LKADQPARRQ DLHHHDEHGV FG               112
//

If you have problems or comments...

PBIL Back to PBIL home page