(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0585

BA000012.MLR0585     Location/Qualifiers
FT   CDS             434831..441274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0585"
FT                   /product="hypothetical glycine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48145"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48145"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG8"
FT                   /protein_id="BAB48145.1"
FT                   /translation="MLFSRGHAGRACVPLNLKLNSSPQEPVMARASEILFLDPSIPDLE
FT                   TALRNVRPEVDAIVLDKRQPAARQMAEALEGRNGLDAVHILAHGAPGRLGFGSGEWSSD
FT                   TLVRDAANLAAIGRALADCGGLRLWSCETGYGAAGEAFVKALSEATGAGVSAAVGLVGA
FT                   EALGGRWDLPISPMSRVAPPLTNTGTASYAGVLSLEVTLTGSLDTAGSISQKAVQYYIT
FT                   NSSNVIVASFTLPSKSSAQFSSVAMIVDVPVSGTYTITALVQDDTDDNNQWSVVSAGTF
FT                   NLSNNSVTSGPSSNSDGVFTLTGVSSTSNSGSTGPTGATGATGATGATGRTGSTGATGS
FT                   TGATGATGATGHTGSTGATGSTGATGSTGATGSTGATGSTGATGATGSTGATGATGATG
FT                   STGATGPTGATGATGATGSTGATGSTGATGATGSTGATGATGATGSTGATGPTGATGAT
FT                   GATGSTGATGSTGATGDTGATGSTGATGSTGATGSTGATGDTGATGSTGATGSTGSTGA
FT                   TGATGDTGATGSTGATGATGATGDTGATGSTGATGSTGDTGATGATGSTGSTGATGSTG
FT                   ATGATGDTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGAT
FT                   GSTGATGATGDTGATGSTGATGSTGSTGATGATGDTGATGSTGATGATGATGDTGATGS
FT                   TGATGSTGATGSTGATGSTGATGATGSTGATGATGSTGATGSTGATGSTGATGSTGATG
FT                   ATGSTGATGSTGATGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGATGDTGAT
FT                   GSTGATGSTGSTGATGDTGATGSTGSTGATGATGSTGATGSTGATGATGSTGDTGATGA
FT                   TGSTGATGSTGATGSTGATGSTGATGSTGDTGATGATGSTGATGSTGATGATGATGSTG
FT                   ATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGDT
FT                   GATGATGSTGATGSTGATGATGATGSTGATGSTGATGSTGATGSTGATGATGSTGATGS
FT                   TGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATG
FT                   STGATGSTGATGSTGATGSTGATGSTGATGSTGSTGATGATGATGSTGATGSTGATGST
FT                   GATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGS
FT                   TGATGATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGASGSTGATG
FT                   STGATGSTGATGSTGATGSTGATGSTGATGATGSTGATGATGSTGATGSTGATGSTGAT
FT                   GSTGATGSTGATGSTGATGATGATGSTGATGSTGATGSTGATGSTGATGATGSTGSTGA
FT                   TGATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTG
FT                   ATGATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGATGSTGAT
FT                   GSTGATGSTGATGSTGASGSTGATGSTGATGSTGATGSTGATGSTGATGATGSTGSTGA
FT                   TGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGASGSTG
FT                   ATGSTGATGSTGATGSTGATGSTGATGATGSTGSTGATGSTGATGSTGATGSTGATGST
FT                   GATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGS
FT                   TGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATG
FT                   STGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGATGSTGAT
FT                   GSTGATGSTGATGATGATGSTGATGSTGATGSTGATGATGSTGATGATGSTGATGSTGS
FT                   TGATGATGSTGATGSTGATGSTGATGSTGATGSTGSTGSTGATGSTGATGSTGAPGPTG
FT                   ATGATGSADDDDKHHHHHHHHGNNGNGDDDRSNRGNRRDQDDDDGKSGNGNNAKVTAST
FT                   LGLKDTTQFLQSGAPDGNSGPGKHASFGQLVGLAATSVTTDLLNVLKTVSGSGNNQNKP
FT                   SGASTDLTSDQTKPGAGYASNEHTVKTSLKDLLKPHE"
     MLFSRGHAGR ACVPLNLKLN SSPQEPVMAR ASEILFLDPS IPDLETALRN VRPEVDAIVL        60
     DKRQPAARQM AEALEGRNGL DAVHILAHGA PGRLGFGSGE WSSDTLVRDA ANLAAIGRAL       120
     ADCGGLRLWS CETGYGAAGE AFVKALSEAT GAGVSAAVGL VGAEALGGRW DLPISPMSRV       180
     APPLTNTGTA SYAGVLSLEV TLTGSLDTAG SISQKAVQYY ITNSSNVIVA SFTLPSKSSA       240
     QFSSVAMIVD VPVSGTYTIT ALVQDDTDDN NQWSVVSAGT FNLSNNSVTS GPSSNSDGVF       300
     TLTGVSSTSN SGSTGPTGAT GATGATGATG RTGSTGATGS TGATGATGAT GHTGSTGATG       360
     STGATGSTGA TGSTGATGST GATGATGSTG ATGATGATGS TGATGPTGAT GATGATGSTG       420
     ATGSTGATGA TGSTGATGAT GATGSTGATG PTGATGATGA TGSTGATGST GATGDTGATG       480
     STGATGSTGA TGSTGATGDT GATGSTGATG STGSTGATGA TGDTGATGST GATGATGATG       540
     DTGATGSTGA TGSTGDTGAT GATGSTGSTG ATGSTGATGA TGDTGATGST GATGSTGATG       600
     STGATGSTGA TGSTGATGST GATGSTGATG STGATGSTGA TGATGDTGAT GSTGATGSTG       660
     STGATGATGD TGATGSTGAT GATGATGDTG ATGSTGATGS TGATGSTGAT GSTGATGATG       720
     STGATGATGS TGATGSTGAT GSTGATGSTG ATGATGSTGA TGSTGATGAT GATGSTGATG       780
     STGATGSTGA TGSTGATGST GATGATGDTG ATGSTGATGS TGSTGATGDT GATGSTGSTG       840
     ATGATGSTGA TGSTGATGAT GSTGDTGATG ATGSTGATGS TGATGSTGAT GSTGATGSTG       900
     DTGATGATGS TGATGSTGAT GATGATGSTG ATGSTGATGS TGATGSTGAT GATGSTGATG       960
     STGATGSTGA TGSTGATGST GATGSTGDTG ATGATGSTGA TGSTGATGAT GATGSTGATG      1020
     STGATGSTGA TGSTGATGAT GSTGATGSTG ATGSTGATGS TGATGSTGAT GSTGATGSTG      1080
     ATGSTGATGS TGATGSTGAT GSTGATGSTG ATGSTGATGS TGATGSTGAT GSTGATGSTG      1140
     STGATGATGA TGSTGATGST GATGSTGATG STGATGSTGA TGSTGATGST GATGSTGATG      1200
     STGATGSTGA TGSTGATGST GATGSTGATG ATGSTGATGS TGATGSTGAT GATGSTGATG      1260
     STGATGSTGA TGSTGASGST GATGSTGATG STGATGSTGA TGSTGATGST GATGATGSTG      1320
     ATGATGSTGA TGSTGATGST GATGSTGATG STGATGSTGA TGATGATGST GATGSTGATG      1380
     STGATGSTGA TGATGSTGST GATGATGSTG ATGSTGATGS TGATGATGST GATGSTGATG      1440
     STGATGSTGA TGSTGATGST GATGATGSTG ATGSTGATGS TGATGATGST GATGSTGATG      1500
     STGATGSTGA TGATGSTGAT GSTGATGSTG ATGSTGASGS TGATGSTGAT GSTGATGSTG      1560
     ATGSTGATGA TGSTGSTGAT GSTGATGSTG ATGSTGATGS TGATGSTGAT GSTGATGSTG      1620
     ATGSTGATGS TGASGSTGAT GSTGATGSTG ATGSTGATGS TGATGATGST GSTGATGSTG      1680
     ATGSTGATGS TGATGSTGAT GSTGATGSTG ATGSTGATGS TGATGSTGAT GSTGATGSTG      1740
     ATGSTGATGS TGATGSTGAT GSTGATGSTG ATGSTGATGS TGATGSTGAT GSTGATGSTG      1800
     ATGSTGATGS TGATGSTGAT GSTGATGSTG ATGATGSTGA TGSTGATGST GATGSTGATG      1860
     STGATGATGS TGATGSTGAT GSTGATGATG ATGSTGATGS TGATGSTGAT GATGSTGATG      1920
     ATGSTGATGS TGSTGATGAT GSTGATGSTG ATGSTGATGS TGATGSTGST GSTGATGSTG      1980
     ATGSTGAPGP TGATGATGSA DDDDKHHHHH HHHGNNGNGD DDRSNRGNRR DQDDDDGKSG      2040
     NGNNAKVTAS TLGLKDTTQF LQSGAPDGNS GPGKHASFGQ LVGLAATSVT TDLLNVLKTV      2100
     SGSGNNQNKP SGASTDLTSD QTKPGAGYAS NEHTVKTSLK DLLKPHE                    2147
//

If you have problems or comments...

PBIL Back to PBIL home page