(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0589

BA000012.MLR0589     Location/Qualifiers
FT   CDS             453740..455146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0589"
FT                   /product="probable secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48148"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48148"
FT                   /db_xref="GOA:Q98MG5"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG5"
FT                   /protein_id="BAB48148.1"
FT                   /translation="MSSTSLTALPARWHRMETRDPTAPAILEFQWPSTAVANAPIPRSA
FT                   RGIVWIVSSLVIALIALAGLIPVDQVVTARGLVVSQSPNIVVQPLETAIVRSIEVREGQ
FT                   RVQAGQLLARLDATFTSADKAALAMQVSTLEAEVARLKAEANGQAFTYDGLDPSWTLQV
FT                   SIFEQRKAVYDAKVENFERQRDELSSVISRSQSDAEGYRQRLTVADSIEQMRRQLEARQ
FT                   VGSRLNTLLAEDNRAEMSRALGNAEQTAEAAKRQQAAVAAERDGYIQGWRAEVSQSLSE
FT                   ASSRISDARELLNKAKLRNQLVELKSQSDAIVQSVAKVSVGSVMQSGERFITLVPADAP
FT                   LEIETNIVGRSSGFVHVGDPVVIKFDTFPYSQYGLAHGTVRALSPDSFSAQEQARDPNS
FT                   SLAMLPSDAEPFYRTRISIDQVALHGVPAGFAVSPGMPVTADVKVGRRTILKYILGVML
FT                   PIGQEAMREP"
     MSSTSLTALP ARWHRMETRD PTAPAILEFQ WPSTAVANAP IPRSARGIVW IVSSLVIALI        60
     ALAGLIPVDQ VVTARGLVVS QSPNIVVQPL ETAIVRSIEV REGQRVQAGQ LLARLDATFT       120
     SADKAALAMQ VSTLEAEVAR LKAEANGQAF TYDGLDPSWT LQVSIFEQRK AVYDAKVENF       180
     ERQRDELSSV ISRSQSDAEG YRQRLTVADS IEQMRRQLEA RQVGSRLNTL LAEDNRAEMS       240
     RALGNAEQTA EAAKRQQAAV AAERDGYIQG WRAEVSQSLS EASSRISDAR ELLNKAKLRN       300
     QLVELKSQSD AIVQSVAKVS VGSVMQSGER FITLVPADAP LEIETNIVGR SSGFVHVGDP       360
     VVIKFDTFPY SQYGLAHGTV RALSPDSFSA QEQARDPNSS LAMLPSDAEP FYRTRISIDQ       420
     VALHGVPAGF AVSPGMPVTA DVKVGRRTIL KYILGVMLPI GQEAMREP                    468
//

If you have problems or comments...

PBIL Back to PBIL home page