(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0590

BA000012.MLR0590     Location/Qualifiers
FT   CDS             455176..456909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0590"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48149"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48149"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG4"
FT                   /protein_id="BAB48149.1"
FT                   /translation="MTILDRLTGLAFPAAVLRRAIKLADSGKAAEAFPLMAKAARAGIV
FT                   DAEYRVARCYLEGAGVPPSRMEGARWLLRAADHGSADAQALLAALYVTGLVTSEADGKG
FT                   PSEHLFKPDSAGKPDFTAAFDFATKAAEAGSATGQAILGYILTSGPASMRDADAAHRWY
FT                   EKSASAGCAEGCLGFALSLARRGKRENRVRIAEEVRRAADAGLPTATYLLAVLTEHGLG
FT                   VARDMAAAAQLYQAAAEKGLPSAQFRLGLALIDGALVGQDVAAGEAWMRRAALAGNIEA
FT                   AYLLGDRHAKTQRPDFAEAANWYRRAAEAGHQAAARALASLYLTGNGVAEDVEEGARWL
FT                   RSSASAGNQQAQTDLANLILGGAGEPDDGASVAGWFEAAASSGDLIAAFNLGLCFAKGV
FT                   GVRQDEGQAAHWLRRAAEGVAEAQYMYARLLQDGRGVAADPTQARVWFARAADAGVLDA
FT                   RVALAEMLLNGRGGMPEPEAAMQLFEQAAADGHAGAMFAIGALYGAGHGLPLDQTTAQK
FT                   WYAAAAGRGHSQAQFMLGRYLLKGLAGERDPVAARLWLERAAAHGISEAADELGAAGGS
FT                   D"
     MTILDRLTGL AFPAAVLRRA IKLADSGKAA EAFPLMAKAA RAGIVDAEYR VARCYLEGAG        60
     VPPSRMEGAR WLLRAADHGS ADAQALLAAL YVTGLVTSEA DGKGPSEHLF KPDSAGKPDF       120
     TAAFDFATKA AEAGSATGQA ILGYILTSGP ASMRDADAAH RWYEKSASAG CAEGCLGFAL       180
     SLARRGKREN RVRIAEEVRR AADAGLPTAT YLLAVLTEHG LGVARDMAAA AQLYQAAAEK       240
     GLPSAQFRLG LALIDGALVG QDVAAGEAWM RRAALAGNIE AAYLLGDRHA KTQRPDFAEA       300
     ANWYRRAAEA GHQAAARALA SLYLTGNGVA EDVEEGARWL RSSASAGNQQ AQTDLANLIL       360
     GGAGEPDDGA SVAGWFEAAA SSGDLIAAFN LGLCFAKGVG VRQDEGQAAH WLRRAAEGVA       420
     EAQYMYARLL QDGRGVAADP TQARVWFARA ADAGVLDARV ALAEMLLNGR GGMPEPEAAM       480
     QLFEQAAADG HAGAMFAIGA LYGAGHGLPL DQTTAQKWYA AAAGRGHSQA QFMLGRYLLK       540
     GLAGERDPVA ARLWLERAAA HGISEAADEL GAAGGSD                                577
//

If you have problems or comments...

PBIL Back to PBIL home page