(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0616

BA000012.MLR0616     Location/Qualifiers
FT   CDS             481297..481779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0616"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48171"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48171"
FT                   /db_xref="GOA:Q98ME2"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98ME2"
FT                   /protein_id="BAB48171.1"
FT                   /translation="MTSALTHLGAQGEANMVDVGDKEETTRTAIAEGFVSMQPETLKTI
FT                   LAGNAKKGDVLGTARIAGIMAAKKTHELIPLCHPLLLTKISVDIEPDHALPGLKVTALA
FT                   RVTGKTGVEMEALTAASVACLTIYDMAKAVDRAMLISGIRLVEKTGGKSGDYKVGA"
     MTSALTHLGA QGEANMVDVG DKEETTRTAI AEGFVSMQPE TLKTILAGNA KKGDVLGTAR        60
     IAGIMAAKKT HELIPLCHPL LLTKISVDIE PDHALPGLKV TALARVTGKT GVEMEALTAA       120
     SVACLTIYDM AKAVDRAMLI SGIRLVEKTG GKSGDYKVGA                             160
//

If you have problems or comments...

PBIL Back to PBIL home page