(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0617

BA000012.MLR0617     Location/Qualifiers
FT   CDS             481779..482984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0617"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48172"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48172"
FT                   /db_xref="GOA:Q98ME1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ME1"
FT                   /protein_id="BAB48172.1"
FT                   /translation="MALVPVAEALERLLDGAAPLAGESVPLFEAVDRVLAEPLAALRTQ
FT                   PPFNASAMDGYAVRAADVASVPSKLTVIGMAPAGRGFDGSLGERQAVRIFTGAPLPEGA
FT                   DTIVIQENVRDLGGGHIEVIEPTAEWRNIRRVGLDFSKGDFLLEKGRLLDPAALSLTAS
FT                   ANHPVVTVVKRPLVAIIATGDELLPPGSELGPDQIISSNAYGVAAVAQSVGARALDLGI
FT                   AADRKDAIAALVKKAVAAGADVIVTLGGASVGDHDLIHDVLTGEGMTLGFWKIAMRPGK
FT                   PLMFGRLGDIRCIGLPGNPVASLVCSQLFLKPLLARLGGRDHRQDIRPARLGAAMPAND
FT                   LRQDYVRAVVREDGGELVATPFSIQDSSMLRMLADANGLIVRAPFAPASAVGDSCSVLM
FT                   LR"
     MALVPVAEAL ERLLDGAAPL AGESVPLFEA VDRVLAEPLA ALRTQPPFNA SAMDGYAVRA        60
     ADVASVPSKL TVIGMAPAGR GFDGSLGERQ AVRIFTGAPL PEGADTIVIQ ENVRDLGGGH       120
     IEVIEPTAEW RNIRRVGLDF SKGDFLLEKG RLLDPAALSL TASANHPVVT VVKRPLVAII       180
     ATGDELLPPG SELGPDQIIS SNAYGVAAVA QSVGARALDL GIAADRKDAI AALVKKAVAA       240
     GADVIVTLGG ASVGDHDLIH DVLTGEGMTL GFWKIAMRPG KPLMFGRLGD IRCIGLPGNP       300
     VASLVCSQLF LKPLLARLGG RDHRQDIRPA RLGAAMPAND LRQDYVRAVV REDGGELVAT       360
     PFSIQDSSML RMLADANGLI VRAPFAPASA VGDSCSVLML R                           401
//

If you have problems or comments...

PBIL Back to PBIL home page