(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0662

BA000012.MLR0662     Location/Qualifiers
FT   CDS             518908..519339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0662"
FT                   /product="probable Hit-like protein involved in cell-cycle
FT                   regulation"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48208"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48208"
FT                   /db_xref="GOA:Q98MA5"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA5"
FT                   /protein_id="BAB48208.1"
FT                   /translation="MAETAYETDNIFAKILRGEIPSHRVYEDDAVVAFMDVMPQGPGHT
FT                   LVVPKAPSRNLLDANPSTFGPLFNVVQKVAQAVKKALNADGVTILQFNEPASGQTVYHL
FT                   HVHVIPRFDGIPLKPHTGTMEKPEVLVEHAEKIRAALGS"
     MAETAYETDN IFAKILRGEI PSHRVYEDDA VVAFMDVMPQ GPGHTLVVPK APSRNLLDAN        60
     PSTFGPLFNV VQKVAQAVKK ALNADGVTIL QFNEPASGQT VYHLHVHVIP RFDGIPLKPH       120
     TGTMEKPEVL VEHAEKIRAA LGS                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page